PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_01258
Common NameKK1_001290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GRAS
Protein Properties Length: 399aa    MW: 45234.4 Da    PI: 6.9114
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_01258genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS263.38.2e-81243972374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn......sseelaalklfsevsPi 90 
                     + Ll++Ae v  +++e+a+ lL +l+ + s  g +p+qR++++f++AL +r+ r++ +   a++ se+++++       ++ ++   + ++  P+
  C.cajan_01258  24 AQFLLAAAERVGCQQFERASVLLFHLQWNPSGGGgSPVQRVVFHFAQALLERIKRETGGGKVAVNKSENNNEErelignLISDTKKAVICHQKIPF 119
                    678**************************8888879*******************777766667666666555677666333444445699999** PP

           GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                     ++ +++  qaI+e v+ ++++H i +di+ G+   +L+qaLa+R+ ++   l+iT++g    + k+ele+tg+rL +fAe+l++pf ++v+++++
  C.cajan_01258 120 NQVMQFAGVQAIVEQVAFQTKIHLINLDIGCGVECTTLMQALAERNeRQVELLKITAIGL---KGKTELEKTGKRLVNFAESLNLPFLYKVVYVTN 212
                    **********************************************555669********...68******************************* PP

           GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                    + ++++e+++++ +Ea+aV + + l +++++s sle+    +++++++++P++++v e ea+hns+sF++rf+eal +y+a+fd++e+ + ++ e 
  C.cajan_01258 213 IIEIKVEQFDIEDNEAVAVYCPIILRTMVSDSDSLEH----LMRVIRKIRPTIMIVLELEANHNSPSFVNRFIEALFFYAAFFDCIETCMKEDYEC 304
                    *****************************99999998....******************************************************* PP

           GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    r+++E   l++ i+++va+e  er+ r+ +   Wr+ + +  + + ++se+   qa+l+ ++++ +d  +v ++ ++l+ gWk+ p+ s+SaW+
  C.cajan_01258 305 RVTIEGI-LSEGIRSIVAMEDGERKVRNVKIDVWRRFFARYRMVETTFSESSLYQANLVAKRFAcGDFCTVGKNGKCLIVGWKGTPIHSISAWK 397
                    *****99.********************************************************99989999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.8611376IPR005202Transcription factor GRAS
PfamPF035142.9E-7824397IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MPMHPYGFGF GILSEEENRD VELAQFLLAA AERVGCQQFE RASVLLFHLQ WNPSGGGGSP  60
VQRVVFHFAQ ALLERIKRET GGGKVAVNKS ENNNEERELI GNLISDTKKA VICHQKIPFN  120
QVMQFAGVQA IVEQVAFQTK IHLINLDIGC GVECTTLMQA LAERNERQVE LLKITAIGLK  180
GKTELEKTGK RLVNFAESLN LPFLYKVVYV TNIIEIKVEQ FDIEDNEAVA VYCPIILRTM  240
VSDSDSLEHL MRVIRKIRPT IMIVLELEAN HNSPSFVNRF IEALFFYAAF FDCIETCMKE  300
DYECRVTIEG ILSEGIRSIV AMEDGERKVR NVKIDVWRRF FARYRMVETT FSESSLYQAN  360
LVAKRFACGD FCTVGKNGKC LIVGWKGTPI HSISAWKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-335739736375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511766.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A151SJZ90.0A0A151SJZ9_CAJCA; DELLA protein RGL1
STRINGGLYMA02G01530.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-47RGA-like 1